Lineage for d6gl8a1 (6gl8 A:9-203)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2575217Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2575295Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2575296Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2575380Protein Bcl-2 [64524] (1 species)
  7. 2575381Species Human (Homo sapiens) [TaxId:9606] [64525] (12 PDB entries)
  8. 3059879Domain d6gl8a1: 6gl8 A:9-203 [359941]
    Other proteins in same PDB: d6gl8a2
    automated match to d2o22a_
    complexed with f3q

Details for d6gl8a1

PDB Entry: 6gl8 (more details), 1.4 Å

PDB Description: crystal structure of bcl-2 in complex with the novel orally active inhibitor s55746
PDB Compounds: (A:) Apoptosis regulator Bcl-2,Apoptosis regulator Bcl-2,Apoptosis regulator Bcl-2,Bcl-2-like protein 1,Apoptosis regulator Bcl-2,Apoptosis regulator Bcl-2,Apoptosis regulator Bcl-2

SCOPe Domain Sequences for d6gl8a1:

Sequence, based on SEQRES records: (download)

>d6gl8a1 f.1.4.1 (A:9-203) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]}
ydnreivmkyihyklsqrgyewdagadveenrteapegtesevvhktlreagddfsrryr
rdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvnremspl
vdnialwmteylnrhlhtwiqdnggwdafvelyg

Sequence, based on observed residues (ATOM records): (download)

>d6gl8a1 f.1.4.1 (A:9-203) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]}
ydnreivmkyihyklsqrgyewdagadesevvhktlreagddfsrryrrdfaemssqlhl
tpftargrfatvveelfrdgvnwgrivaffefggvmcvesvnremsplvdnialwmteyl
nrhlhtwiqdnggwdafvelyg

SCOPe Domain Coordinates for d6gl8a1:

Click to download the PDB-style file with coordinates for d6gl8a1.
(The format of our PDB-style files is described here.)

Timeline for d6gl8a1:

  • d6gl8a1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6gl8a2