Lineage for d6a45b_ (6a45 B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2462855Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2463460Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2463834Protein Three prime repair exonuclease 2, TREX2 [142499] (2 species)
  7. 3059842Species Mus musculus [TaxId:10090] [359904] (2 PDB entries)
  8. 3059858Domain d6a45b_: 6a45 B: [359920]
    automated match to d1y97b_
    complexed with po4

Details for d6a45b_

PDB Entry: 6a45 (more details), 1.9 Å

PDB Description: structure of mouse trex2
PDB Compounds: (B:) Three prime repair exonuclease 2

SCOPe Domain Sequences for d6a45b_:

Sequence, based on SEQRES records: (download)

>d6a45b_ c.55.3.5 (B:) Three prime repair exonuclease 2, TREX2 {Mus musculus [TaxId: 10090]}
praetfvfldleatglpnmdpeiaeislfavhrsslenperddsgslvlprvldkltlcm
cperpftakaseitglsseslmhcgkagfngavvrtlqgflsrqegpiclvahngfdydf
pllctelqrlgahlpqdtvcldtlpalrgldrahshgtraqgrksyslaslfhryfqaep
saahsaegdvhtllliflhrapellawadeqarswahiepmy

Sequence, based on observed residues (ATOM records): (download)

>d6a45b_ c.55.3.5 (B:) Three prime repair exonuclease 2, TREX2 {Mus musculus [TaxId: 10090]}
praetfvfldleatglpnmdpeiaeislfavhrsslenperdgslvlprvldkltlcmcp
erpftakaseitglsseslmhcgkagfngavvrtlqgflsrqegpiclvahngfdydfpl
lctelqrlgahlpqdtvcldtlpalrgldrahksyslaslfhryfqaepsaahsaegdvh
tllliflhrapellawadeqarswahiepmy

SCOPe Domain Coordinates for d6a45b_:

Click to download the PDB-style file with coordinates for d6a45b_.
(The format of our PDB-style files is described here.)

Timeline for d6a45b_:

  • d6a45b_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08