SCOPe 2.08: Domain d6a46a_: 6a46 A:

Lineage for d6a46a_ (6a46 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Three prime repair exonuclease 2, TREX2 [142499] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [359904] (2 PDB entries)

8. Domain d6a46a_: 6a46 A: [359916]
   automated match to d1y97b_
   protein/DNA complex; complexed with ca, dcm, mg

Details for d6a46a_

PDB Entry: 6a46, 2 Å

PDB Description: structure of trex2 in complex with a nucleotide (dcmp)

PDB Compounds: (A:) Three prime repair exonuclease 2

SCOPe Domain Sequences for d6a46a_:

Sequence, based on SEQRES records:

>d6a46a_ c.55.3.5 (A:) Three prime repair exonuclease 2, TREX2 {Mouse (Mus musculus) [TaxId: 10090]}
eppraetfvfldleatglpnmdpeiaeislfavhrsslenperddsgslvlprvldkltl
cmcperpftakaseitglsseslmhcgkagfngavvrtlqgflsrqegpiclvahngfdy
dfpllctelqrlgahlpqdtvcldtlpalrgldrahshgtraqgrksyslaslfhryfqa
epsaahsaegdvhtllliflhrapellawadeqarswahiepmyvppdgp

Sequence, based on observed residues (ATOM records):

>d6a46a_ c.55.3.5 (A:) Three prime repair exonuclease 2, TREX2 {Mouse (Mus musculus) [TaxId: 10090]}
eppraetfvfldleatglpnmdpeiaeislfavhrsslenperddsgslvlprvldkltl
cmcperpftakaseitglsseslmhcgkagfngavvrtlqgflsrqegpiclvahngfdy
dfpllctelqrlgahlpqdtvcldtlpalrgldrahsrksyslaslfhryfqaepsaahs
aegdvhtllliflhrapellawadeqarswahiepmyvppdgp

Timeline for d6a46a_:

• d6a46a_ first appeared in SCOPe 2.07