Lineage for d6a46a_ (6a46 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2462855Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2463460Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2463834Protein Three prime repair exonuclease 2, TREX2 [142499] (2 species)
  7. 3059842Species Mus musculus [TaxId:10090] [359904] (2 PDB entries)
  8. 3059854Domain d6a46a_: 6a46 A: [359916]
    automated match to d1y97b_
    protein/DNA complex; complexed with ca, dcm, mg

Details for d6a46a_

PDB Entry: 6a46 (more details), 2 Å

PDB Description: structure of trex2 in complex with a nucleotide (dcmp)
PDB Compounds: (A:) Three prime repair exonuclease 2

SCOPe Domain Sequences for d6a46a_:

Sequence, based on SEQRES records: (download)

>d6a46a_ c.55.3.5 (A:) Three prime repair exonuclease 2, TREX2 {Mus musculus [TaxId: 10090]}
eppraetfvfldleatglpnmdpeiaeislfavhrsslenperddsgslvlprvldkltl
cmcperpftakaseitglsseslmhcgkagfngavvrtlqgflsrqegpiclvahngfdy
dfpllctelqrlgahlpqdtvcldtlpalrgldrahshgtraqgrksyslaslfhryfqa
epsaahsaegdvhtllliflhrapellawadeqarswahiepmyvppdgp

Sequence, based on observed residues (ATOM records): (download)

>d6a46a_ c.55.3.5 (A:) Three prime repair exonuclease 2, TREX2 {Mus musculus [TaxId: 10090]}
eppraetfvfldleatglpnmdpeiaeislfavhrsslenperddsgslvlprvldkltl
cmcperpftakaseitglsseslmhcgkagfngavvrtlqgflsrqegpiclvahngfdy
dfpllctelqrlgahlpqdtvcldtlpalrgldrahsrksyslaslfhryfqaepsaahs
aegdvhtllliflhrapellawadeqarswahiepmyvppdgp

SCOPe Domain Coordinates for d6a46a_:

Click to download the PDB-style file with coordinates for d6a46a_.
(The format of our PDB-style files is described here.)

Timeline for d6a46a_:

  • d6a46a_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08