Lineage for d1d6fa1 (1d6f A:1-235)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 28463Family c.95.1.2: Chalcone synthase [53914] (2 proteins)
  6. 28464Protein Chalcone synthase [53915] (1 species)
  7. 28465Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (9 PDB entries)
  8. 28472Domain d1d6fa1: 1d6f A:1-235 [35991]

Details for d1d6fa1

PDB Entry: 1d6f (more details), 1.69 Å

PDB Description: chalcone synthase c164a mutant

SCOP Domain Sequences for d1d6fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6fa1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa)}
mvsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmc
dksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqp
kskithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgafaggtvlrlakdlaen
nkgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekp

SCOP Domain Coordinates for d1d6fa1:

Click to download the PDB-style file with coordinates for d1d6fa1.
(The format of our PDB-style files is described here.)

Timeline for d1d6fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d6fa2