Lineage for d6h39f_ (6h39 F:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548740Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2548741Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2548925Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2549037Protein Proteasome alpha subunit (non-catalytic) [56255] (9 species)
    contains an extension to the common fold at the N-terminus
  7. 2549053Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (235 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 3059838Domain d6h39f_: 6h39 F: [359900]
    Other proteins in same PDB: d6h39a_, d6h39h_, d6h39i_, d6h39j_, d6h39k_, d6h39l_, d6h39m_, d6h39n_, d6h39v_, d6h39w_, d6h39x_, d6h39y_, d6h39z_
    automated match to d4cr2g_
    complexed with cl, fgy, mes, mg, so4

Details for d6h39f_

PDB Entry: 6h39 (more details), 2.5 Å

PDB Description: yeast 20s proteasome in complex with the peptidic non-covalent binding inhibitor rts-v5
PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d6h39f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h39f_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d6h39f_:

Click to download the PDB-style file with coordinates for d6h39f_.
(The format of our PDB-style files is described here.)

Timeline for d6h39f_:

  • d6h39f_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08