Lineage for d6gjra_ (6gjr A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397365Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2397366Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2397367Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2397368Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2397383Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (123 PDB entries)
    Uniprot P05092
  8. 3059820Domain d6gjra_: 6gjr A: [359882]
    automated match to d1w8ma_
    complexed with f0w

Details for d6gjra_

PDB Entry: 6gjr (more details), 1.69 Å

PDB Description: cyclophilin a complexed with tri-vector ligand 9.
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase A

SCOPe Domain Sequences for d6gjra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gjra_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOPe Domain Coordinates for d6gjra_:

Click to download the PDB-style file with coordinates for d6gjra_.
(The format of our PDB-style files is described here.)

Timeline for d6gjra_:

  • d6gjra_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08