Lineage for d6gwua_ (6gwu A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460607Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2460672Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2460790Family c.53.2.0: automated matches [191506] (1 protein)
    not a true family
  6. 2460791Protein automated matches [190830] (11 species)
    not a true protein
  7. 3059815Species Candida albicans [TaxId:5476] [359877] (1 PDB entry)
  8. 3059816Domain d6gwua_: 6gwu A: [359878]
    automated match to d4o1ja_
    complexed with bme, peg, pge, zn

Details for d6gwua_

PDB Entry: 6gwu (more details), 2.2 Å

PDB Description: carbonic anhydrase cance103p from candida albicans
PDB Compounds: (A:) carbonic anhydrase

SCOPe Domain Sequences for d6gwua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gwua_ c.53.2.0 (A:) automated matches {Candida albicans [TaxId: 5476]}
nfpftlssestlqdflnnnkffvdsikhnhgnqifdlngqgqsphtlwigcsdsragdqc
latlpgeifvhrnianivnandissqgviqfaidvlkvkkiivcghtdcggiwaslskkk
iggvldlwlnpvrhiraanlklleeynqdpklkakklaelnvissvtalkrhpsasvalk
kneievwgmlydvatgylsqveipqdef

SCOPe Domain Coordinates for d6gwua_:

Click to download the PDB-style file with coordinates for d6gwua_.
(The format of our PDB-style files is described here.)

Timeline for d6gwua_:

  • d6gwua_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08