Lineage for d6etya2 (6ety A:118-350)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434394Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2434544Superfamily c.8.4: PA domain [52025] (1 family) (S)
  5. 2434545Family c.8.4.1: PA domain [52026] (2 proteins)
  6. 2434546Protein Glutamate carboxypeptidase II [141984] (1 species)
  7. 2434547Species Human (Homo sapiens) [TaxId:9606] [141985] (33 PDB entries)
    Uniprot Q04609 118-350
  8. 3059808Domain d6etya2: 6ety A:118-350 [359870]
    Other proteins in same PDB: d6etya1, d6etya3
    automated match to d2c6ca2
    complexed with bma, bxk, ca, cl, man, nag, zn

Details for d6etya2

PDB Entry: 6ety (more details), 1.68 Å

PDB Description: x-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a inhibitor jhu3371
PDB Compounds: (A:) glutamate carboxypeptidase 2

SCOPe Domain Sequences for d6etya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6etya2 c.8.4.1 (A:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv
nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap
gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi
gyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstn

SCOPe Domain Coordinates for d6etya2:

Click to download the PDB-style file with coordinates for d6etya2.
(The format of our PDB-style files is described here.)

Timeline for d6etya2:

  • d6etya2 appears in periodic updates to SCOPe 2.07 starting on 2018-11-08