Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) Pfam PF16454 |
Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 proteins) |
Protein automated matches [310859] (2 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [311310] (7 PDB entries) |
Domain d6g6wb_: 6g6w B: [359858] automated match to d5dxub_ complexed with eo5 |
PDB Entry: 6g6w (more details), 2.72 Å
SCOPe Domain Sequences for d6g6wb_:
Sequence, based on SEQRES records: (download)
>d6g6wb_ h.4.21.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} dnieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnetikifeeqcq tqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlkkqaaeyrei dkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg
>d6g6wb_ h.4.21.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} dnieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnetikifeeqcq tqeryskeyiekteiqrimhnyeklksriseivdsrrrleedlkkqaaeyreidkrmnsi kpdliqlrktrdqylmwltqkgvrqkklnewlg
Timeline for d6g6wb_: