Lineage for d6g6wb_ (6g6w B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3042247Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 3042445Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) (S)
    Pfam PF16454
  5. 3042446Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 proteins)
  6. 3042450Protein automated matches [310859] (2 species)
    not a true protein
  7. 3042451Species Cow (Bos taurus) [TaxId:9913] [311310] (7 PDB entries)
  8. 3042457Domain d6g6wb_: 6g6w B: [359858]
    automated match to d5dxub_
    complexed with eo5

Details for d6g6wb_

PDB Entry: 6g6w (more details), 2.72 Å

PDB Description: human pi3kdelta in complex with ligand lasw1976
PDB Compounds: (B:) Phosphatidylinositol 3-kinase regulatory subunit alpha

SCOPe Domain Sequences for d6g6wb_:

Sequence, based on SEQRES records: (download)

>d6g6wb_ h.4.21.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dnieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnetikifeeqcq
tqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlkkqaaeyrei
dkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg

Sequence, based on observed residues (ATOM records): (download)

>d6g6wb_ h.4.21.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dnieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnetikifeeqcq
tqeryskeyiekteiqrimhnyeklksriseivdsrrrleedlkkqaaeyreidkrmnsi
kpdliqlrktrdqylmwltqkgvrqkklnewlg

SCOPe Domain Coordinates for d6g6wb_:

Click to download the PDB-style file with coordinates for d6g6wb_.
(The format of our PDB-style files is described here.)

Timeline for d6g6wb_: