Lineage for d6eaqc1 (6eaq C:5-86)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2354769Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2355180Protein automated matches [190803] (2 species)
    not a true protein
  7. 2355181Species Human (Homo sapiens) [TaxId:9606] [188070] (28 PDB entries)
  8. 3059790Domain d6eaqc1: 6eaq C:5-86 [359852]
    Other proteins in same PDB: d6eaqa1, d6eaqa2, d6eaqb1, d6eaqb2
    automated match to d1fnla1
    complexed with bma, gal, man, nag

Details for d6eaqc1

PDB Entry: 6eaq (more details), 2.22 Å

PDB Description: glycosylated fcgr3b / cd16b in complex with afucosylated igg1 fc
PDB Compounds: (C:) low affinity immunoglobulin gamma fc region receptor III-b

SCOPe Domain Sequences for d6eaqc1:

Sequence, based on SEQRES records: (download)

>d6eaqc1 b.1.1.4 (C:5-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpkavvflepqwysvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatvq
dsgeyrcqtqlstlsdpvqlev

Sequence, based on observed residues (ATOM records): (download)

>d6eaqc1 b.1.1.4 (C:5-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpkavvflepqwysvlekdsvtlkcqgastqwfhneslissqassyfidaatvqdsgeyr
cqtqlstlsdpvqlev

SCOPe Domain Coordinates for d6eaqc1:

Click to download the PDB-style file with coordinates for d6eaqc1.
(The format of our PDB-style files is described here.)

Timeline for d6eaqc1:

  • d6eaqc1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-08