Lineage for d6fyuf_ (6fyu F:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (20 species)
    not a true protein
  7. 2347651Species Llama (Lama glama) [TaxId:9844] [187485] (170 PDB entries)
  8. 3059787Domain d6fyuf_: 6fyu F: [359849]
    Other proteins in same PDB: d6fyua_, d6fyub_, d6fyud_, d6fyue_, d6fyug_, d6fyuh_
    automated match to d4b5eb_
    complexed with na, nag

Details for d6fyuf_

PDB Entry: 6fyu (more details), 2.64 Å

PDB Description: structure of h7(a/shanghai/2/2013) influenza hemagglutinin in complex sd36
PDB Compounds: (F:) Single domain antibody SD36

SCOPe Domain Sequences for d6fyuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fyuf_ b.1.1.1 (F:) automated matches {Llama (Lama glama) [TaxId: 9844]}
evqlvesggglvqaggslklscaasgrtyamgwfrqapgkerefvahinalgtrtyysds
vkgrftisrdnaknteylemnnlkpedtavyyctaqgqwraapvavaaeyefwgqgtqvt
vs

SCOPe Domain Coordinates for d6fyuf_:

Click to download the PDB-style file with coordinates for d6fyuf_.
(The format of our PDB-style files is described here.)

Timeline for d6fyuf_:

  • d6fyuf_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08