Lineage for d6foga_ (6fog A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2561549Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 2561550Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 2561551Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. 2561607Protein automated matches [191123] (3 species)
    not a true protein
  7. 3059750Species Homo sapiens [TaxId:9606] [359812] (2 PDB entries)
  8. 3059786Domain d6foga_: 6fog A: [359848]
    automated match to d1sawb_
    complexed with cl, mg, oxl

Details for d6foga_

PDB Entry: 6fog (more details), 1.94 Å

PDB Description: x-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution.
PDB Compounds: (A:) Acylpyruvase FAHD1, mitochondrial

SCOPe Domain Sequences for d6foga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6foga_ d.177.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]}
asrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspilmpayt
rnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksf
tascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleeg
diiltgtpkgvgpvkendeieagihglvsmtfkvekpe

SCOPe Domain Coordinates for d6foga_:

Click to download the PDB-style file with coordinates for d6foga_.
(The format of our PDB-style files is described here.)

Timeline for d6foga_:

  • d6foga_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08