Lineage for d6eaqa1 (6eaq A:235-339)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (861 PDB entries)
  8. 3059783Domain d6eaqa1: 6eaq A:235-339 [359845]
    Other proteins in same PDB: d6eaqc1, d6eaqc2
    automated match to d1hzhh3
    complexed with bma, gal, man, nag

Details for d6eaqa1

PDB Entry: 6eaq (more details), 2.22 Å

PDB Description: glycosylated fcgr3b / cd16b in complex with afucosylated igg1 fc
PDB Compounds: (A:) Immunoglobulin gamma-1 heavy chain

SCOPe Domain Sequences for d6eaqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6eaqa1 b.1.1.2 (A:235-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpree
qynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d6eaqa1:

Click to download the PDB-style file with coordinates for d6eaqa1.
(The format of our PDB-style files is described here.)

Timeline for d6eaqa1:

  • d6eaqa1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-08