SCOPe 2.07: Domain d6eaqb2: 6eaq B:340-444

Lineage for d6eaqb2 (6eaq B:340-444)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6eaqb2: 6eaq B:340-444 [359844]
   Other proteins in same PDB: d6eaqc1, d6eaqc2
   automated match to d1hzhh4
   complexed with bma, gal, man, nag

Details for d6eaqb2

PDB Entry: 6eaq, 2.22 Å

PDB Description: glycosylated fcgr3b / cd16b in complex with afucosylated igg1 fc

PDB Compounds: (B:) Immunoglobulin gamma-1 heavy chain

SCOPe Domain Sequences for d6eaqb2:

Sequence; same for both SEQRES and ATOM records:

>d6eaqb2 b.1.1.2 (B:340-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

Timeline for d6eaqb2:

• d6eaqb2 is new in SCOPe 2.07-stable
  
• d6eaqb2 appears in the current release, SCOPe 2.08