Lineage for d6etba1 (6etb A:2-249)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555981Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2555982Protein automated matches [190418] (23 species)
    not a true protein
  7. 2556011Species Escherichia coli [TaxId:83333] [259349] (4 PDB entries)
  8. 3059762Domain d6etba1: 6etb A:2-249 [359824]
    Other proteins in same PDB: d6etba2, d6etbb2
    automated match to d4d02a1
    complexed with fe, fmn, o, oxy; mutant

Details for d6etba1

PDB Entry: 6etb (more details), 1.91 Å

PDB Description: aerobic s262y mutation of e. coli flrd core
PDB Compounds: (A:) anaerobic nitric oxide reductase flavorubredoxin

SCOPe Domain Sequences for d6etba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6etba1 d.157.1.0 (A:2-249) automated matches {Escherichia coli [TaxId: 83333]}
sivvknnihwvgqrdwevrdfhgteyktlrgssynsylireeknvlidtvdhkfsrefvq
nlrneidladidyivinhaeedhagaltelmaqipdtpiyctanaidsinghhhhpewnf
nvvktgdtldigngkqlifvetpmlhwpdsmmtyltgdavlfsndafgqhycdehlfnde
vdqtelfeqcqryyaniltpfsrlvtpkiteilgfnlpvdmiatshgvvwrdnptqivel
ylkwaady

SCOPe Domain Coordinates for d6etba1:

Click to download the PDB-style file with coordinates for d6etba1.
(The format of our PDB-style files is described here.)

Timeline for d6etba1:

  • d6etba1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6etba2