Lineage for d6etcx_ (6etc X:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2368998Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2368999Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2369124Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2369125Protein automated matches [191109] (11 species)
    not a true protein
  7. 2369174Species Human (Homo sapiens) [TaxId:9606] [230909] (12 PDB entries)
  8. 3059749Domain d6etcx_: 6etc X: [359811]
    automated match to d4gr7a_
    mutant

Details for d6etcx_

PDB Entry: 6etc (more details), 1.2 Å

PDB Description: crystal structure of human gamma-d-crystallin mutant p23t+r36s at 1.2 angstroms resolution
PDB Compounds: (X:) Gamma-crystallin D

SCOPe Domain Sequences for d6etcx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6etcx_ b.11.1.0 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkitlyedrgfqgrhyecssdhtnlqpylsrcnsasvdsgcwmlyeqpnysglqyflrrg
dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvidfs

SCOPe Domain Coordinates for d6etcx_:

Click to download the PDB-style file with coordinates for d6etcx_.
(The format of our PDB-style files is described here.)

Timeline for d6etcx_:

  • d6etcx_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08