Lineage for d6e5va_ (6e5v A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485265Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2485266Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2485563Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2485564Protein automated matches [190646] (74 species)
    not a true protein
  7. 2485726Species Human (Homo sapiens) [TaxId:9606] [189363] (15 PDB entries)
  8. 3059748Domain d6e5va_: 6e5v A: [359810]
    automated match to d5c5ca_
    complexed with cl, hvg

Details for d6e5va_

PDB Entry: 6e5v (more details), 2.95 Å

PDB Description: human mglu8 receptor amino terminal domain in complex with (s)-3,4- dicarboxyphenylglycine (dcpg)
PDB Compounds: (A:) Metabotropic glutamate receptor 8

SCOPe Domain Sequences for d6e5va_:

Sequence, based on SEQRES records: (download)

>d6e5va_ c.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsirvdgdiilgglfpvhakgergvpcgelkkekgihrleamlyaidqinkdpdllsnit
lgvrildtcsrdtyaleqsltfvqaliekdasdvkcangdppiftkpdkisgvigaaass
vsimvanilrlfkipqisyastapelsdntrydffsrvvppdsyqaqamvdivtalgwny
vstlasegnygesgveaftqisreiggvsiaqsqkipreprpgefekiikrlletpnara
vimfaneddirrileaakklnqsghflwigsdswgskiapvyqqeeiaegavtilpkras
idgfdryfrsrtlannrrnvwfaefweenfgcklgshgkrnshikkctgleriardssye
qegkvqfvidavysmayalhnmhkdlcpgyiglcprmstidgkellgyiravnfngsagt
pvtfnengdapgrydifqyqitnksteykvighwtnqlhlkvedmqwa

Sequence, based on observed residues (ATOM records): (download)

>d6e5va_ c.93.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsirvdgdiilgglfpvhakgergvpcgelkkekgihrleamlyaidqinkdpdllsnit
lgvrildtcsrdtyaleqsltfvqalipdkisgvigaaassvsimvanilrlfkipqisy
astapelsdntrydffsrvvppdsyqaqamvdivtalgwnyvstlasegnygesgveaft
qisreiggvsiaqsqkipreprpgefekiikrlletpnaravimfaneddirrileaakk
lnqsghflwigsdswgskiapvyqqeeiaegavtilpkrasidgfdryfrsrtlannrrn
vwfaefweenfgcklctgleriardssyeqegkvqfvidavysmayalhnmhkdlcpgyi
glcprmstidgkellgyiravnfngsagtpvtfnengdapgrydifqyqitsteykvigh
wtnqlhlkvedmqwa

SCOPe Domain Coordinates for d6e5va_:

Click to download the PDB-style file with coordinates for d6e5va_.
(The format of our PDB-style files is described here.)

Timeline for d6e5va_:

  • d6e5va_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-08