Lineage for d6dzqa1 (6dzq A:1-198)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459948Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2459949Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2460385Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2460386Protein PA N-terminal domain [254375] (6 species)
  7. 2460409Species Influenza A virus [TaxId:93838] [254808] (66 PDB entries)
  8. 3059741Domain d6dzqa1: 6dzq A:1-198 [359803]
    Other proteins in same PDB: d6dzqa2
    automated match to d4e5ed_
    complexed with edo, hjp, mn

Details for d6dzqa1

PDB Entry: 6dzq (more details), 2.25 Å

PDB Description: the n-terminal domain of pa endonuclease from the influenza h1n1 virus in complex with 3-hydroxy-6-methyl-4-oxo-4h-pyran-2-carboxylic acid
PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d6dzqa1:

Sequence, based on SEQRES records: (download)

>d6dzqa1 c.52.1.34 (A:1-198) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfgsgdpnall
khrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyyl
ekankiksekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfr
qserge

Sequence, based on observed residues (ATOM records): (download)

>d6dzqa1 c.52.1.34 (A:1-198) PA N-terminal domain {Influenza A virus [TaxId: 93838]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfghrfeiieg
rdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyylekankikse
kthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqserge

SCOPe Domain Coordinates for d6dzqa1:

Click to download the PDB-style file with coordinates for d6dzqa1.
(The format of our PDB-style files is described here.)

Timeline for d6dzqa1:

  • d6dzqa1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6dzqa2