SCOP 1.55: Domain d1hn9b2: 1hn9 B:1175-1317

Lineage for d1hn9b2 (1hn9 B:1175-1317)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
4. Superfamily c.95.1: Thiolase-like [53901] (2 families)
5. Family c.95.1.1: Thiolase-related [53902] (5 proteins)
6. Protein Ketoacyl-ACP synthase III (FabH) [53912] (1 species)
7. Species Escherichia coli [TaxId:562] [53913] (6 PDB entries)

8. Domain d1hn9b2: 1hn9 B:1175-1317 [35980]

Details for d1hn9b2

PDB Entry: 1hn9, 2 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii

SCOP Domain Sequences for d1hn9b2:

Sequence; same for both SEQRES and ATOM records:

>d1hn9b2 c.95.1.1 (B:1175-1317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli}
isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannld
rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik
pgqlvlleafgggftwgsalvrf

Timeline for d1hn9b2:

• d1hn9b2 appears in SCOP 1.57
  
• d1hn9b2 appears in the current release, SCOPe 2.08