Lineage for d6dxlb_ (6dxl B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011892Fold d.387: STING C-terminal-like [254119] (1 superfamily)
    5 helices and 5 strands in one mixed beta-sheet, one long bent helix
  4. 3011893Superfamily d.387.1: STING, TM173 CTD-like [254144] (2 families) (S)
    Pfam PF15009, PubMed 22579474
  5. 3011894Family d.387.1.1: Tyrosinase cofactor MelC1 [254191] (2 proteins)
  6. 3011895Protein Tyrosinase cofactor MelC1 [254420] (1 species)
  7. 3011896Species Human (Homo sapiens) [TaxId:9606] [254863] (48 PDB entries)
  8. 3011952Domain d6dxlb_: 6dxl B: [359799]
    automated match to d4f5wa_
    protein/DNA complex; complexed with ca, hg4

Details for d6dxlb_

PDB Entry: 6dxl (more details), 2.45 Å

PDB Description: linked amidobenzimidazole sting agonist
PDB Compounds: (B:) Stimulator of interferon protein

SCOPe Domain Sequences for d6dxlb_:

Sequence, based on SEQRES records: (download)

>d6dxlb_ d.387.1.1 (B:) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
fnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnl
smadpnirfldklpqqtgdragikdrvysnsiyellengqragtcvleyatplqtlfams
qysqagfsredrleqaklfcrtlediladapesqnncrliayqepaddssfslsqevlrh
lrqeekeevtv

Sequence, based on observed residues (ATOM records): (download)

>d6dxlb_ d.387.1.1 (B:) Tyrosinase cofactor MelC1 {Human (Homo sapiens) [TaxId: 9606]}
fnvahglawsyyigylrlilpelqarirtynqhynnllrgavsqrlyillpldcgvpdnl
smadpnirfldklpqqtvysnsiyellengqragtcvleyatplqtlfamsqysqagfsr
edrleqaklfcrtlediladapesqnncrliayqepssfslsqevlrhlrqeekeevtv

SCOPe Domain Coordinates for d6dxlb_:

Click to download the PDB-style file with coordinates for d6dxlb_.
(The format of our PDB-style files is described here.)

Timeline for d6dxlb_: