Lineage for d6bica1 (6bic A:1-173)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2389935Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2390138Protein automated matches [190384] (20 species)
    not a true protein
  7. 2390239Species Norwalk virus [TaxId:524364] [313606] (14 PDB entries)
  8. 3059733Domain d6bica1: 6bic A:1-173 [359795]
    Other proteins in same PDB: d6bica2, d6bicb2
    automated match to d2fyqa_
    complexed with 5lh

Details for d6bica1

PDB Entry: 6bic (more details), 2.25 Å

PDB Description: 2.25 a resolution structure of norovirus 3cl protease in complex with a triazole-based macrocyclic inhibitor
PDB Compounds: (A:) 3C-like protease

SCOPe Domain Sequences for d6bica1:

Sequence, based on SEQRES records: (download)

>d6bica1 b.47.1.4 (A:1-173) automated matches {Norwalk virus [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf
skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
lltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa

Sequence, based on observed residues (ATOM records): (download)

>d6bica1 b.47.1.4 (A:1-173) automated matches {Norwalk virus [TaxId: 524364]}
apptlwsrvtkfgsgwgfwvsptvfittthvvpteffgeplssiaihqageftqfrfskk
mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmlld
lgtipgdcgapyvhkrndwvvcgvhaaatksgntvvcavqa

SCOPe Domain Coordinates for d6bica1:

Click to download the PDB-style file with coordinates for d6bica1.
(The format of our PDB-style files is described here.)

Timeline for d6bica1:

  • d6bica1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6bica2