Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein automated matches [190384] (21 species) not a true protein |
Species Norwalk virus [TaxId:524364] [313606] (14 PDB entries) |
Domain d6bica1: 6bic A:1-173 [359795] Other proteins in same PDB: d6bica2, d6bicb2 automated match to d2fyqa_ complexed with 5lh |
PDB Entry: 6bic (more details), 2.25 Å
SCOPe Domain Sequences for d6bica1:
Sequence, based on SEQRES records: (download)
>d6bica1 b.47.1.4 (A:1-173) automated matches {Norwalk virus [TaxId: 524364]} apptlwsrvtkfgsgwgfwvsptvfittthvvptgvkeffgeplssiaihqageftqfrf skkmrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm lltganakgmdlgtipgdcgapyvhkrgndwvvcgvhaaatksgntvvcavqa
>d6bica1 b.47.1.4 (A:1-173) automated matches {Norwalk virus [TaxId: 524364]} apptlwsrvtkfgsgwgfwvsptvfittthvvpteffgeplssiaihqageftqfrfskk mrpdltgmvleegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmlld lgtipgdcgapyvhkrndwvvcgvhaaatksgntvvcavqa
Timeline for d6bica1: