Lineage for d1hn9b1 (1hn9 B:1001-1174)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75535Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. 75536Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 75537Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 75631Protein Ketoacyl-ACP synthase III (FabH) [53912] (2 species)
  7. 75632Species Escherichia coli [TaxId:562] [53913] (6 PDB entries)
  8. 75643Domain d1hn9b1: 1hn9 B:1001-1174 [35979]

Details for d1hn9b1

PDB Entry: 1hn9 (more details), 2 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase iii

SCOP Domain Sequences for d1hn9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn9b1 c.95.1.1 (B:1001-1174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli}
mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgi

SCOP Domain Coordinates for d1hn9b1:

Click to download the PDB-style file with coordinates for d1hn9b1.
(The format of our PDB-style files is described here.)

Timeline for d1hn9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hn9b2