Lineage for d6bi8c1 (6bi8 C:4-78)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2501111Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2502613Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2502614Protein automated matches [190233] (26 species)
    not a true protein
  7. 2502649Species Human (Homo sapiens) [TaxId:9606] [187090] (88 PDB entries)
  8. 3059706Domain d6bi8c1: 6bi8 C:4-78 [359768]
    automated match to d5chwa1
    complexed with aye, cit, edo, gol, pge, zn

Details for d6bi8c1

PDB Entry: 6bi8 (more details), 3 Å

PDB Description: x-ray structure of mers coronavirus papain-like protease in complex with human isg15
PDB Compounds: (C:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d6bi8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bi8c1 d.15.1.0 (C:4-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasq
glgpgstvllvvdks

SCOPe Domain Coordinates for d6bi8c1:

Click to download the PDB-style file with coordinates for d6bi8c1.
(The format of our PDB-style files is described here.)

Timeline for d6bi8c1:

  • d6bi8c1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-08

View in 3D
Domains from same chain:
(mouse over for more information)
d6bi8c2