SCOPe 2.08: Domain d6bi8d1: 6bi8 D:4-78

Lineage for d6bi8d1 (6bi8 D:4-78)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (156 PDB entries)

8. Domain d6bi8d1: 6bi8 D:4-78 [359746]
   automated match to d5chwa1
   complexed with aye, cit, edo, gol, pge, zn

Details for d6bi8d1

PDB Entry: 6bi8, 2.29 Å

PDB Description: x-ray structure of mers coronavirus papain-like protease in complex with human isg15

PDB Compounds: (D:) Ubiquitin-like protein ISG15

SCOPe Domain Sequences for d6bi8d1:

Sequence; same for both SEQRES and ATOM records:

>d6bi8d1 d.15.1.0 (D:4-78) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dltvkmlagnefqvslsssmsvselkaqitqkigvhafqqrlavhpsgvalqdrvplasq
glgpgstvllvvdks

Timeline for d6bi8d1:

• d6bi8d1 first appeared in SCOPe 2.07