Lineage for d1ebla2 (1ebl A:175-317)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75535Fold c.95: Thiolase-like [53900] (1 superfamily)
  4. 75536Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 75537Family c.95.1.1: Thiolase-related [53902] (5 proteins)
  6. 75631Protein Ketoacyl-ACP synthase III (FabH) [53912] (2 species)
  7. 75632Species Escherichia coli [TaxId:562] [53913] (6 PDB entries)
  8. 75638Domain d1ebla2: 1ebl A:175-317 [35974]

Details for d1ebla2

PDB Entry: 1ebl (more details), 1.8 Å

PDB Description: the 1.8 a crystal structure and active site architecture of beta- ketoacyl-[acyl carrier protein] synthase iii (fabh) from escherichia coli

SCOP Domain Sequences for d1ebla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebla2 c.95.1.1 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli}
isthlhadgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannnd
rsqldwlvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrik
pgqlvlleafgggftwgsalvrf

SCOP Domain Coordinates for d1ebla2:

Click to download the PDB-style file with coordinates for d1ebla2.
(The format of our PDB-style files is described here.)

Timeline for d1ebla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ebla1