Lineage for d6frmc2 (6frm C:256-408)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439108Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2439628Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2439629Protein automated matches [190158] (29 species)
    not a true protein
  7. 3058201Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358263] (2 PDB entries)
  8. 3059666Domain d6frmc2: 6frm C:256-408 [359728]
    Other proteins in same PDB: d6frma1, d6frmb1, d6frmc1, d6frmd1, d6frme1, d6frmf1, d6frmg1, d6frmh1
    automated match to d2ohha2
    complexed with 7mt, cl, fe, fmn, tb

Details for d6frmc2

PDB Entry: 6frm (more details), 2.2 Å

PDB Description: crystal structure of coenzyme f420h2 oxidase (fpra) co-crystallized with 10 mm tb-xo4
PDB Compounds: (C:) Crystal Structure of coenzyme F420H2 oxidase (FprA) co-crystallized with 10 mM Tb-Xo4

SCOPe Domain Sequences for d6frmc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6frmc2 c.23.5.0 (C:256-408) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]}
ckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnderseivkdildskafllg
aptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggngggtkvlaeklkecgfev
ldeyelyyvptedelekcynmgkrlavkvkemk

SCOPe Domain Coordinates for d6frmc2:

Click to download the PDB-style file with coordinates for d6frmc2.
(The format of our PDB-style files is described here.)

Timeline for d6frmc2:

  • d6frmc2 appears in periodic updates to SCOPe 2.07 starting on 2018-11-01