Lineage for d6frmc1 (6frm C:1-255)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555486Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2555487Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2555981Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2555982Protein automated matches [190418] (24 species)
    not a true protein
  7. 3058199Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358261] (2 PDB entries)
  8. 3059665Domain d6frmc1: 6frm C:1-255 [359727]
    Other proteins in same PDB: d6frma2, d6frmb2, d6frmc2, d6frmd2, d6frme2, d6frmf2, d6frmg2, d6frmh2
    automated match to d2ohha1
    complexed with 7mt, cl, fe, fmn, tb

Details for d6frmc1

PDB Entry: 6frm (more details), 2.2 Å

PDB Description: crystal structure of coenzyme f420h2 oxidase (fpra) co-crystallized with 10 mm tb-xo4
PDB Compounds: (C:) Crystal Structure of coenzyme F420H2 oxidase (FprA) co-crystallized with 10 mM Tb-Xo4

SCOPe Domain Sequences for d6frmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6frmc1 d.157.1.0 (C:1-255) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]}
mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft
qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd
pmkvigayqdfatgk

SCOPe Domain Coordinates for d6frmc1:

Click to download the PDB-style file with coordinates for d6frmc1.
(The format of our PDB-style files is described here.)

Timeline for d6frmc1:

  • d6frmc1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-01