Lineage for d6fseb_ (6fse B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2474357Family c.69.1.1: Acetylcholinesterase-like [53475] (6 proteins)
    automatically mapped to Pfam PF00135
  6. 2474358Protein Acetylcholinesterase [53476] (6 species)
  7. 2474399Species Mouse (Mus musculus) [TaxId:10090] [53479] (36 PDB entries)
  8. 3059644Domain d6fseb_: 6fse B: [359706]
    automated match to d1maac_
    complexed with 1pg, e5k, peg, pg0

Details for d6fseb_

PDB Entry: 6fse (more details), 2.7 Å

PDB Description: mus musculus acetylcholinesterase in complex with 1-(4-(4- ethylpiperazin-1-yl)piperidin-1-yl)-2-((4'-methoxy-[1,1'-biphenyl]-4- yl)oxy)ethanone dihydrochloride (15)
PDB Compounds: (B:) acetylcholinesterase

SCOPe Domain Sequences for d6fseb_:

Sequence, based on SEQRES records: (download)

>d6fseb_ c.69.1.1 (B:) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
arrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv
dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv
rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga
rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf
artgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat

Sequence, based on observed residues (ATOM records): (download)

>d6fseb_ c.69.1.1 (B:) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
arrratllarlvgcndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvvdgdflsd
tpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagvrigvpqa
sdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqgarvyayif
ehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnfartgdpn
dprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkllsat

SCOPe Domain Coordinates for d6fseb_:

Click to download the PDB-style file with coordinates for d6fseb_.
(The format of our PDB-style files is described here.)

Timeline for d6fseb_:

  • d6fseb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01