SCOPe 2.08: Domain d6bfzf1: 6bfz F:0-139

Lineage for d6bfzf1 (6bfz F:0-139)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [359490] (4 PDB entries)

8. Domain d6bfzf1: 6bfz F:0-139 [359700]
   Other proteins in same PDB: d6bfza2, d6bfza3, d6bfzb2, d6bfzb3, d6bfzc2, d6bfzc3, d6bfzd2, d6bfzd3, d6bfze2, d6bfze3, d6bfzf2, d6bfzf3
   automated match to d2fyma2
   complexed with 2pg, gol, mes, mg, pep, so4

Details for d6bfzf1

PDB Entry: 6bfz, 2.21 Å

PDB Description: crystal structure of enolase from e. coli with a mixture of apo form, substrate, and product form

PDB Compounds: (F:) enolase

SCOPe Domain Sequences for d6bfzf1:

Sequence; same for both SEQRES and ATOM records:

>d6bfzf1 d.54.1.0 (F:0-139) automated matches {Escherichia coli [TaxId: 562]}
mskivkiigreiidsrgnptveaevhleggfvgmaaapsgastgsrealelrdgdksrfl
gkgvtkavaavngpiaqaligkdakdqagidkimidldgtenkskfganailavslanak
aaaaakgmplyehiaelngt

Timeline for d6bfzf1:

• d6bfzf1 first appeared in SCOPe 2.07