Lineage for d5yb0f_ (5yb0 F:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (132 species)
    not a true protein
  7. 2472443Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [311267] (8 PDB entries)
  8. 3059626Domain d5yb0f_: 5yb0 F: [359688]
    automated match to d1w3ua_
    complexed with cl, plp

Details for d5yb0f_

PDB Entry: 5yb0 (more details), 2.94 Å

PDB Description: crystal structure of wild type phosphoserine aminotransferase (psat) from e. histolytica
PDB Compounds: (F:) phosphoserine aminotransferase

SCOPe Domain Sequences for d5yb0f_:

Sequence, based on SEQRES records: (download)

>d5yb0f_ c.67.1.0 (F:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
ihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdip
egyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdkn
ytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysli
yagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnqt
lkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfvmeeqykqle
nefseyalqkgiigikghrsvggfrasiynavtiesvqalikc

Sequence, based on observed residues (ATOM records): (download)

>d5yb0f_ c.67.1.0 (F:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
ihnfgagpaamakevieatakavnnfweglsileishrskewinvmnetkalmkevmdip
egyeilffgggaslqflmvamnllnkkacyldtgvwaskaikeaenigevkiigtskdkn
ytyipeyqipsdydyfhittnntiygteirkdiespiplvadmssdilskpidiskysli
yagaqkncgaagvtiviikkeilgkvqrkipiildyqvhilnnsmyntppvisiftvnqt
lkyikkigglkkiqelneekarllyaeidrnkifrgtvrkkdrsimnvcfiigikghrsv
ggfrasiynavtiesvqalikc

SCOPe Domain Coordinates for d5yb0f_:

Click to download the PDB-style file with coordinates for d5yb0f_.
(The format of our PDB-style files is described here.)

Timeline for d5yb0f_:

  • d5yb0f_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01