Lineage for d6mqha_ (6mqh A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2420459Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2421872Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2421873Protein automated matches [190115] (80 species)
    not a true protein
  7. 3059596Species Burkholderia mallei [TaxId:243160] [359658] (1 PDB entry)
  8. 3059620Domain d6mqha_: 6mqh A: [359682]
    automated match to d3s5na_

Details for d6mqha_

PDB Entry: 6mqh (more details), 1.7 Å

PDB Description: crystal structure of 4-hydroxy-tetrahydrodipicolinate synthase (htpa synthase) from burkholderia mallei
PDB Compounds: (A:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d6mqha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mqha_ c.1.10.0 (A:) automated matches {Burkholderia mallei [TaxId: 243160]}
giqirgsvpaivtpmledggldlaafrklidwhieegtdalvvvgtsgesatlsvdehvl
mietavkhaakripivagaggnstteaielskhakavgadatlqvvpyynkptqegiyrh
fkaiaeavdlpvilynvpgrtvadmsnettlrlaqvpgiigvkdatgnidraaqlikaap
ahfsiysgddptaialmllgghgnisvtanvapramselcraalaadvktareihmklls
lhkhlfieanpipvkwalqqmgkiaggirlpltplderchetvrgalreagll

SCOPe Domain Coordinates for d6mqha_:

Click to download the PDB-style file with coordinates for d6mqha_.
(The format of our PDB-style files is described here.)

Timeline for d6mqha_:

  • d6mqha_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01

View in 3D
Domains from other chains:
(mouse over for more information)
d6mqhb_