Lineage for d6mubl2 (6mub L:107-212)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (861 PDB entries)
  8. 3059607Domain d6mubl2: 6mub L:107-212 [359669]
    Other proteins in same PDB: d6mubk1, d6mubl1
    automated match to d3cfja2
    complexed with bma, man

Details for d6mubl2

PDB Entry: 6mub (more details), 2.5 Å

PDB Description: anti-hiv-1 fab 2g12 + man5 re-refinement
PDB Compounds: (L:) FAB 2G12, light chain

SCOPe Domain Sequences for d6mubl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mubl2 b.1.1.2 (L:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d6mubl2:

Click to download the PDB-style file with coordinates for d6mubl2.
(The format of our PDB-style files is described here.)

Timeline for d6mubl2:

  • d6mubl2 appears in periodic updates to SCOPe 2.07 starting on 2018-11-01

View in 3D
Domains from same chain:
(mouse over for more information)
d6mubl1