Lineage for d6bgea_ (6bge A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2449972Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2450535Protein automated matches [190393] (12 species)
    not a true protein
  7. 3059598Species Helicobacter pylori [TaxId:210] [359660] (1 PDB entry)
  8. 3059599Domain d6bgea_: 6bge A: [359661]
    automated match to d1g6oa_
    complexed with dn7, epe, gol, so4

Details for d6bgea_

PDB Entry: 6bge (more details), 2.9 Å

PDB Description: helicobacter pylori atpase, hp0525, in complex with 1g4 compound
PDB Compounds: (A:) VirB11-like protein

SCOPe Domain Sequences for d6bgea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bgea_ c.37.1.11 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
lsaedkkfleveralkeaalnplrhateelfgdflkmeniteicyngnkvvwvlknngew
qpfdvrdrkafslsrlmhfarccasfkkktidnyenpilssnlangervqivlspvtvnd
etisisiripskttyphsffeeqgfynlldnkeqaisaikdgiaigknvivcggtgsgkt
tyiksimefipkeeriisiedteeivfkhhknytqlffggnitsadclksclrmrpdrii
lgelrsseaydfynvlcsghkgtlttlhagsseeafirlanmsssnsaarnikfeslieg
fkdlidmivhinhhkqcdefyik

SCOPe Domain Coordinates for d6bgea_:

Click to download the PDB-style file with coordinates for d6bgea_.
(The format of our PDB-style files is described here.)

Timeline for d6bgea_:

  • d6bgea_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01