Lineage for d5za1a_ (5za1 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2336455Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2336456Protein automated matches [191142] (6 species)
    not a true protein
  7. 2336571Species Nomascus leucogenys [TaxId:61853] [335245] (12 PDB entries)
  8. 3059592Domain d5za1a_: 5za1 A: [359654]
    Other proteins in same PDB: d5za1b2
    automated match to d5x8sb_
    complexed with 9a0, dmf, edo

Details for d5za1a_

PDB Entry: 5za1 (more details), 2.52 Å

PDB Description: ligand complex of rorgt lbd
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5za1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5za1a_ a.123.1.0 (A:) automated matches {Nomascus leucogenys [TaxId: 61853]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivv

SCOPe Domain Coordinates for d5za1a_:

Click to download the PDB-style file with coordinates for d5za1a_.
(The format of our PDB-style files is described here.)

Timeline for d5za1a_:

  • d5za1a_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01