Lineage for d5za1b1 (5za1 B:265-487)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2336455Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2336456Protein automated matches [191142] (6 species)
    not a true protein
  7. 2336571Species Nomascus leucogenys [TaxId:61853] [335245] (10 PDB entries)
  8. 3059590Domain d5za1b1: 5za1 B:265-487 [359652]
    Other proteins in same PDB: d5za1b2
    automated match to d5x8sb_
    complexed with 9a0, dmf, edo

Details for d5za1b1

PDB Entry: 5za1 (more details), 2.52 Å

PDB Description: ligand complex of rorgt lbd
PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5za1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5za1b1 a.123.1.0 (B:265-487) automated matches {Nomascus leucogenys [TaxId: 61853]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifq

SCOPe Domain Coordinates for d5za1b1:

Click to download the PDB-style file with coordinates for d5za1b1.
(The format of our PDB-style files is described here.)

Timeline for d5za1b1:

  • d5za1b1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-01

View in 3D
Domains from same chain:
(mouse over for more information)
d5za1b2
View in 3D
Domains from other chains:
(mouse over for more information)
d5za1a_