Lineage for d6mrfa1 (6mrf A:2-261)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538139Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2538140Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2538141Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2538277Protein automated matches [195197] (5 species)
    not a true protein
  7. 3059586Species Acinetobacter baumannii [TaxId:470] [359648] (1 PDB entry)
  8. 3059587Domain d6mrfa1: 6mrf A:2-261 [359649]
    Other proteins in same PDB: d6mrfa2
    automated match to d4fo7b_
    complexed with edo, na

Details for d6mrfa1

PDB Entry: 6mrf (more details), 1.65 Å

PDB Description: crystal structure of a methionine aminopeptidase metap from acinetobacter baumannii
PDB Compounds: (A:) Methionine aminopeptidase

SCOPe Domain Sequences for d6mrfa1:

Sequence, based on SEQRES records: (download)

>d6mrfa1 d.127.1.1 (A:2-261) automated matches {Acinetobacter baumannii [TaxId: 470]}
iktpdeiekmriagrlaaevldmikphikagvstleldticrnhienvqhaipacvgygg
apgrpafqhsictsvnhvvchgipsenkilkngdilnidvtvikdgyhgdtnmmyivgge
tsilanrlckvaqeamyrgmatvrdgsylgdighaiqkyveserfsvvreycghgigtvf
hdepqvlhygqagtgmrleagmtftiepmvnagvwqtkllgdkwtvvtkdhklsaqyeht
ilvtktgievltarpeedls

Sequence, based on observed residues (ATOM records): (download)

>d6mrfa1 d.127.1.1 (A:2-261) automated matches {Acinetobacter baumannii [TaxId: 470]}
iktpdeiekmriagrlaaevldmikphikagvstleldticrnhienvqhaipacvgyfq
hsictsvnhvvchgipsenkilkngdilnidvtvikdgyhgdtnmmyivggetsilanrl
ckvaqeamyrgmatvrdgsylgdighaiqkyveserfsvvreycghgigtqvlhygqagt
gmrleagmtftiepmvnagvwqtkllgdkwtvvtkdhklsaqyehtilvtktgievltar
peedls

SCOPe Domain Coordinates for d6mrfa1:

Click to download the PDB-style file with coordinates for d6mrfa1.
(The format of our PDB-style files is described here.)

Timeline for d6mrfa1:

  • d6mrfa1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-01

View in 3D
Domains from same chain:
(mouse over for more information)
d6mrfa2