Lineage for d6muqa_ (6muq A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (55 species)
    not a true protein
  7. 3059583Species Yersinia enterocolitica [TaxId:930944] [359645] (1 PDB entry)
  8. 3059584Domain d6muqa_: 6muq A: [359646]
    automated match to d6azia_
    complexed with act, so4

Details for d6muqa_

PDB Entry: 6muq (more details), 1.67 Å

PDB Description: 1.67 angstrom resolution crystal structure of murein-dd-endopeptidase from yersinia enterocolitica.
PDB Compounds: (A:) Murein-DD-endopeptidase

SCOPe Domain Sequences for d6muqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6muqa_ e.3.1.0 (A:) automated matches {Yersinia enterocolitica [TaxId: 930944]}
evkgkaplelasgsamvvdlqtnkviyannadevvpiasitklmtamvvldaklpldeii
svdihqtkemkgvfsrvrvnseisrkdmlllalmssenraaaslahhypggynafinamn
akakslgmtktryveptglsinnvstardltklliatkqypligqlstttekmatfrepn
ytlpfrntnhlvyndkwniqltktgftnqaghclamrtvignrpvalvvldafgkythfa
danrlrswmetgkaapipgaaksyrqq

SCOPe Domain Coordinates for d6muqa_:

Click to download the PDB-style file with coordinates for d6muqa_.
(The format of our PDB-style files is described here.)

Timeline for d6muqa_:

  • d6muqa_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01