Lineage for d5qina_ (5qin A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2546221Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2546222Protein automated matches [190417] (28 species)
    not a true protein
  7. 2546365Species Human (Homo sapiens) [TaxId:9606] [187294] (1049 PDB entries)
  8. 3059578Domain d5qina_: 5qin A: [359640]
    automated match to d5e92a_
    complexed with gol, j2v, mg

Details for d5qina_

PDB Entry: 5qin (more details), 1.57 Å

PDB Description: tgf-beta receptor type 2 kinase domain in complex with n- {4-[3-(6- methoxypyridin-3-yl)-1h-pyrrolo[3,2-b]pyridin-2- yl]pyridin-2- yl}acetamide
PDB Compounds: (A:) TGF-beta receptor type-2

SCOPe Domain Sequences for d5qina_:

Sequence, based on SEQRES records: (download)

>d5qina_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ellpieldtlvgkgrfaevykaklkqntseqfetvavkifpyeeyaswktekdifsdinl
khenilqfltaeerktelgkqywlitafhakgnlqeyltrhviswedlrklgsslargia
hlhsdhtpcgrpkmpivhrdlkssnilvkndltcclcdfglslrldptlsvddlansgqv
gtarymapevlasamnlenvesfkqtdvysmalvlwemtsrcnavgevkdyeppfgskvr
ehpcvasmadnvladagrpeipsfwlnhqgiqmvcetltecwdhdpearltaqcvaerfs
el

Sequence, based on observed residues (ATOM records): (download)

>d5qina_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ellpieldtlvgkgrfaevykaklkqfetvavkifpyeeyaswktekdifsdinlkheni
lqfltaeerktelgkqywlitafhakgnlqeyltrhviswedlrklgsslargiahlhsd
htpcgrpkmpivhrdlkssnilvkndltcclcdfglslrldptlsvddlanqvgtaryma
pevlasamnlenvesfkqtdvysmalvlwemtsrcnavgevkdyeppfgskvrehpcvas
madnvladagrpeipsfwlnhqgiqmvcetltecwdhdpearltaqcvaerfsel

SCOPe Domain Coordinates for d5qina_:

Click to download the PDB-style file with coordinates for d5qina_.
(The format of our PDB-style files is described here.)

Timeline for d5qina_:

  • d5qina_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01