Lineage for d5yuoa_ (5yuo A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2382816Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 2383008Protein automated matches [190206] (10 species)
    not a true protein
  7. 3058599Species Pseudomonas aeruginosa [TaxId:208964] [358661] (2 PDB entries)
  8. 3059570Domain d5yuoa_: 5yuo A: [359632]
    automated match to d1eygd_
    complexed with gol

Details for d5yuoa_

PDB Entry: 5yuo (more details), 2.04 Å

PDB Description: crystal structure of ssb protein from pseudomonas aeruginosa pao1
PDB Compounds: (A:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d5yuoa_:

Sequence, based on SEQRES records: (download)

>d5yuoa_ b.40.4.3 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
gvnkvilvgnvggdpetrympngnavtnitlatseswkdkqtgqqqertewhrvvffgrl
aeiageylrkgsqvyvegslrtrkwqgqdgqdrytteivvdingnmqllggr

Sequence, based on observed residues (ATOM records): (download)

>d5yuoa_ b.40.4.3 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
gvnkvilvgnvggdpetrympngnavtnitlatseswertewhrvvffgrlaeiageylr
kgsqvyvegslrtrkwqdgqdrytteivvdingnmqllggr

SCOPe Domain Coordinates for d5yuoa_:

Click to download the PDB-style file with coordinates for d5yuoa_.
(The format of our PDB-style files is described here.)

Timeline for d5yuoa_:

  • d5yuoa_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01