Lineage for d6hskb_ (6hsk B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2453552Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2453553Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2453831Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. 2453876Protein automated matches [190786] (1 species)
    not a true protein
  7. 2453877Species Human (Homo sapiens) [TaxId:9606] [188039] (35 PDB entries)
  8. 3059566Domain d6hskb_: 6hsk B: [359628]
    automated match to d2v5wb_
    complexed with gok, k, zn

Details for d6hskb_

PDB Entry: 6hsk (more details), 2.1 Å

PDB Description: crystal structure of a human hdac8 l6 loop mutant complexed with quisinostat
PDB Compounds: (B:) Histone deacetylase 8

SCOPe Domain Sequences for d6hskb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hskb_ c.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
aylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckv
ainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsfts
kvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyq
afnpkavvlqlgadtisgdrlgcfnmtpvgigkclkyilqwqlatlilggggynlantar
cwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnl
khvv

SCOPe Domain Coordinates for d6hskb_:

Click to download the PDB-style file with coordinates for d6hskb_.
(The format of our PDB-style files is described here.)

Timeline for d6hskb_:

  • d6hskb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01