Lineage for d6mjka1 (6mjk A:1-142)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2406647Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2406808Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2407003Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2407004Protein automated matches [191182] (17 species)
    not a true protein
  7. 2407172Species Naegleria fowleri [TaxId:5763] [334024] (2 PDB entries)
  8. 3059564Domain d6mjka1: 6mjk A:1-142 [359626]
    Other proteins in same PDB: d6mjka2
    automated match to d4oopb_
    complexed with dur, mg, ppv

Details for d6mjka1

PDB Entry: 6mjk (more details), 1.45 Å

PDB Description: crystal structure of dutp pyrophosphatase protein, from naegleria fowleri in complex with deoxyuridine
PDB Compounds: (A:) dUTP pyrophosphatase

SCOPe Domain Sequences for d6mjka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mjka1 b.85.4.0 (A:1-142) automated matches {Naegleria fowleri [TaxId: 5763]}
mstpqlmrvkklsefailpvrssqfaagfdlasaydyvvpargkclvktdlavavphgyy
grvaprsglavknfidvgagvvdsdyrgnlgvllfnhgdedfkiargdriaqfvieqial
pdivevddldetergaggfgst

SCOPe Domain Coordinates for d6mjka1:

Click to download the PDB-style file with coordinates for d6mjka1.
(The format of our PDB-style files is described here.)

Timeline for d6mjka1:

  • d6mjka1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-01

View in 3D
Domains from same chain:
(mouse over for more information)
d6mjka2