SCOPe 2.08: Domain d6bftb2: 6bft B:107-214

Lineage for d6bftb2 (6bft B:107-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d6bftb2: 6bft B:107-214 [359625]
   Other proteins in same PDB: d6bftb1, d6bftc_, d6bftg_, d6bftl1
   automated match to d1dn0a2
   complexed with mes, so4; mutant

Details for d6bftb2

PDB Entry: 6bft, 2.55 Å

PDB Description: structure of bevacizumab fab mutant in complex with vegf

PDB Compounds: (B:) Avastin Light Chain Fab fragment mutant

SCOPe Domain Sequences for d6bftb2:

Sequence; same for both SEQRES and ATOM records:

>d6bftb2 b.1.1.2 (B:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d6bftb2:

• d6bftb2 first appeared in SCOPe 2.07