Lineage for d6mu3h2 (6mu3 H:116-227)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747669Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2747676Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2747757Domain d6mu3h2: 6mu3 H:116-227 [359615]
    Other proteins in same PDB: d6mu3h1, d6mu3k1, d6mu3k2, d6mu3l1, d6mu3l2, d6mu3m1
    automated match to d1op3h2
    complexed with bma, man

Details for d6mu3h2

PDB Entry: 6mu3 (more details), 2.33 Å

PDB Description: anti-hiv-1 fab 2g12 + man7 re-refinement
PDB Compounds: (H:) FAB 2G12, heavy chain

SCOPe Domain Sequences for d6mu3h2:

Sequence, based on SEQRES records: (download)

>d6mu3h2 b.1.1.2 (H:116-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records): (download)

>d6mu3h2 b.1.1.2 (H:116-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
tkgpsvfplapsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslss
vvtvpssslgtqtyicnvnhkpsntkvdkkvep

SCOPe Domain Coordinates for d6mu3h2:

Click to download the PDB-style file with coordinates for d6mu3h2.
(The format of our PDB-style files is described here.)

Timeline for d6mu3h2: