Lineage for d6mrga_ (6mrg A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2492678Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
    possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2492679Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) (S)
    automatically mapped to Pfam PF01425
  5. 2492680Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 proteins)
  6. 2492747Protein automated matches [191046] (2 species)
    not a true protein
  7. 2492748Species Norway rat (Rattus norvegicus) [TaxId:10116] [188885] (20 PDB entries)
  8. 3059545Domain d6mrga_: 6mrg A: [359607]
    automated match to d3pr0b_
    complexed with jxv

Details for d6mrga_

PDB Entry: 6mrg (more details), 2.77 Å

PDB Description: faah bound to non covalent inhibitor
PDB Compounds: (A:) fatty-acid amide hydrolase 1

SCOPe Domain Sequences for d6mrga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mrga_ c.117.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
tgrqkargaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgel
speavfftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghd
stlglslnegmpsesdcvvvqvlklqgavpfvhtnvpqsmfsydcsnplfgqtmnpwkss
kspggssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvy
gqtavqlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyye
tdnytmpspamrralietkqrleaaghtlipflpnnipyalevlstgglfsdggrsflqn
fkgdfvdpclgdlililrlpswfkrllslllkplfprlaaflnnmrprsaeklwklqhei
emyrqsviaqwkamnldvlltpmlgpaldlntpgratgavsytmlyncldfpagvvpvtt
vtaeddaqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveql
mtp

SCOPe Domain Coordinates for d6mrga_:

Click to download the PDB-style file with coordinates for d6mrga_.
(The format of our PDB-style files is described here.)

Timeline for d6mrga_:

  • d6mrga_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01