Lineage for d6m7fa_ (6m7f A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337561Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2337562Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2337969Family a.128.1.0: automated matches [196408] (1 protein)
    not a true family
  6. 2337970Protein automated matches [196409] (40 species)
    not a true protein
  7. 3059484Species Streptomyces clavuligerus [TaxId:443255] [359546] (2 PDB entries)
  8. 3059542Domain d6m7fa_: 6m7f A: [359604]
    automated match to d5i1ua_

Details for d6m7fa_

PDB Entry: 6m7f (more details), 3.05 Å

PDB Description: wild-type cucumene synthase
PDB Compounds: (A:) Cucumene Synthase

SCOPe Domain Sequences for d6m7fa_:

Sequence, based on SEQRES records: (download)

>d6m7fa_ a.128.1.0 (A:) automated matches {Streptomyces clavuligerus [TaxId: 443255]}
fdlpwplrkhpgvagarehclgwlaaqgladrrgltaetfvtwqldelagyffpratqeg
lelatdlmvwyfapfddqfdgalgrdprrtagvcaglaevlygvpepgpvasspvgralg
dlwrrsctgmspfwrtrarhnwtgylaahtaesvpryhgrtvdaaycvrqrgyatsshvi
mdliertggfevpamvwhhpvlvelrtltsemigisndlcsaekeeadgdlsnnlllvle
nhegldrpeaieraraltaervarfldveravtdvdclldgagreavrrfveglhdlvrg
dnewertt

Sequence, based on observed residues (ATOM records): (download)

>d6m7fa_ a.128.1.0 (A:) automated matches {Streptomyces clavuligerus [TaxId: 443255]}
fdlpwplrkhpgvagarehclgwlaaqglagltaetfvtwqldelagyffpratqeglel
atdlmvwyfapfddqfdgalgrdprrtagvcaglaevlygvpepgpvasspvgralgdlw
rrsctgmspfwrtrarhnwtgylaahtaesvprydaaycvrqrgyatsshvimdliertg
gfevpamvwhhpvlvelrtltsemigisndlcsaesnnlllvlenhegldrpeaierara
ltaervarfldveravtdvdclldgagreavrrfveglhdlvrgdnewertt

SCOPe Domain Coordinates for d6m7fa_:

Click to download the PDB-style file with coordinates for d6m7fa_.
(The format of our PDB-style files is described here.)

Timeline for d6m7fa_:

  • d6m7fa_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01

View in 3D
Domains from other chains:
(mouse over for more information)
d6m7fc_