Lineage for d6hqha_ (6hqh A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2487255Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2487256Protein automated matches [190039] (147 species)
    not a true protein
  7. 2488033Species Rhizobium radiobacter [TaxId:358] [343165] (2 PDB entries)
  8. 3059539Domain d6hqha_: 6hqh A: [359601]
    automated match to d5loma_
    complexed with edo, snw

Details for d6hqha_

PDB Entry: 6hqh (more details), 1.8 Å

PDB Description: structure of agrobacterium tumefaciens b6 strain pbp soca complexed with deoxyfructosylglutamine (dfg) at 1.8 a resolution
PDB Compounds: (A:) Membrane-bound lytic murein transglycosylase F

SCOPe Domain Sequences for d6hqha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6hqha_ c.94.1.0 (A:) automated matches {Rhizobium radiobacter [TaxId: 358]}
dnplglidpttisvgtmgdakpyafttadgnftgfdielflnvagrlgfkkeqvvftgqe
fsalmpsvangrfdvaaaaigttakrketvdfsdgylagflsvltseagitdaaglkgkr
lgvvqgtlqeiyaeknfagtdlvkfpdnnsavsalnngtvdahfldfeaakdysarypal
kiavnipsfdapagfvirkgndalrnaldkglkeamqdgtwkklhekwfpgtpmpaaylp
kq

SCOPe Domain Coordinates for d6hqha_:

Click to download the PDB-style file with coordinates for d6hqha_.
(The format of our PDB-style files is described here.)

Timeline for d6hqha_:

  • d6hqha_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01