Lineage for d6d0cb_ (6d0c B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534513Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2534777Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2535027Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2535028Protein automated matches [190492] (20 species)
    not a true protein
  7. 2535063Species Human (Homo sapiens) [TaxId:9606] [187434] (25 PDB entries)
  8. 3059520Domain d6d0cb_: 6d0c B: [359582]
    Other proteins in same PDB: d6d0ca1, d6d0ca2
    automated match to d3f1nb_

Details for d6d0cb_

PDB Entry: 6d0c (more details), 1.5 Å

PDB Description: crystal structure of hif2a-b*:arnt-b* complex
PDB Compounds: (B:) Aryl hydrocarbon receptor nuclear translocator

SCOPe Domain Sequences for d6d0cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6d0cb_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvvk
lkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvkns

SCOPe Domain Coordinates for d6d0cb_:

Click to download the PDB-style file with coordinates for d6d0cb_.
(The format of our PDB-style files is described here.)

Timeline for d6d0cb_:

  • d6d0cb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01