Lineage for d6fk5a1 (6fk5 A:1-256)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548549Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2548550Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2548661Family d.151.1.0: automated matches [191468] (1 protein)
    not a true family
  6. 2548662Protein automated matches [190734] (13 species)
    not a true protein
  7. 3059516Species Neisseria meningitidis [TaxId:122586] [359578] (1 PDB entry)
  8. 3059517Domain d6fk5a1: 6fk5 A:1-256 [359579]
    Other proteins in same PDB: d6fk5a2
    automated match to d2jc4a_
    complexed with mg, mpd

Details for d6fk5a1

PDB Entry: 6fk5 (more details), 2.02 Å

PDB Description: structure of 3' phosphatase nexo (d146n) from neisseria bound to dna substrate in presence of magnesium ion
PDB Compounds: (A:) NExo D146N

SCOPe Domain Sequences for d6fk5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fk5a1 d.151.1.0 (A:1-256) automated matches {Neisseria meningitidis [TaxId: 122586]}
mkittwnvnslnvrlpqvqnlladnppdilvlqelkldqdkfpaaalqmmgwhcvwsgqk
tyngvaivsrsvpqdvhfglpalpddpqrrviaatvsgvrvinvycvngealdspkfkyk
eqwfaaltefvrdemtrhgklvllgnfniapadadcydpekwhekihcssverqwfqnll
dlgltdslrqvhpegafytwfdyrgamfqrklglridhilvspamaaalkdvrvdletra
lerpsdhapvtaefdw

SCOPe Domain Coordinates for d6fk5a1:

Click to download the PDB-style file with coordinates for d6fk5a1.
(The format of our PDB-style files is described here.)

Timeline for d6fk5a1:

  • d6fk5a1 appears in periodic updates to SCOPe 2.07 starting on 2018-11-01