Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins) Pfam PF00630 |
Protein Filamin a [141023] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141024] (8 PDB entries) Uniprot P21333 1863-1953! Uniprot P21333 1863-1955! Uniprot P21333 2236-2328 |
Domain d6ew1a1: 6ew1 A:478-573 [359563] Other proteins in same PDB: d6ew1a4 automated match to d2dica1 mutant |
PDB Entry: 6ew1 (more details), 2.31 Å
SCOPe Domain Sequences for d6ew1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ew1a1 b.1.18.10 (A:478-573) Filamin a {Human (Homo sapiens) [TaxId: 9606]} cnpsacravgrglqpkgvrvketadfkvytkgagsgelkvtvkgpkgeervkqkdlgdgv ygfeyypmvpgtyivtitwggqnigrspfevkvgte
Timeline for d6ew1a1: