Lineage for d6eokb_ (6eok B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484020Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2484021Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2484022Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 proteins)
    automatically mapped to Pfam PF00710
  6. 2484023Protein Asparaginase type II [53776] (5 species)
  7. 2484053Species Escherichia coli [TaxId:562] [53777] (8 PDB entries)
  8. 3059500Domain d6eokb_: 6eok B: [359562]
    automated match to d1nnsa_
    complexed with zn

Details for d6eokb_

PDB Entry: 6eok (more details), 2.5 Å

PDB Description: crystal structure of e. coli l-asparaginase ii
PDB Compounds: (B:) L-asparaginase 2

SCOPe Domain Sequences for d6eokb_:

Sequence, based on SEQRES records: (download)

>d6eokb_ c.88.1.1 (B:) Asparaginase type II {Escherichia coli [TaxId: 562]}
lpnitilatggtiagggdsatksnytvgkvgvenlvnavpqlkdianvkgeqvvnigsqd
mndnvwltlakkintdcdktdgfvithgtdtmeetayfldltvkcdkpvvmvgamrpsts
msadgpfnlynavvtaadkasanrgvlvvmndtvldgrdvtktnttdvatfksvnygplg
yihngkidyqrtparkhtsdtpfdvsklnelpkvgivynyanasdlpakalvdagydgiv
sagvgngnlyksvfdtlataaktgtavvrssrvptgattqdaevddakygfvasgtlnpq
karvllqlaltqtkdpqqiqqifnqy

Sequence, based on observed residues (ATOM records): (download)

>d6eokb_ c.88.1.1 (B:) Asparaginase type II {Escherichia coli [TaxId: 562]}
lpnitilatggtiavpqlkdianvkgeqvvnigsqdmndnvwltlakkintdcdktdgfv
ithgtdtmeetayfldltvkcdkpvvmvgamrpstsmsadgpfnlynavvtaadkasanr
gvlvvmndtvldgrdvtktnttdvatfksvnygplgyihngkidyqrtparkhtsdtpfd
vsklnelpkvgivynyanasdlpakalvdagydgivsagvgngnlyksvfdtlataaktg
tavvrssrvptgattqdaevddakygfvasgtlnpqkarvllqlaltqtkdpqqiqqifn
qy

SCOPe Domain Coordinates for d6eokb_:

Click to download the PDB-style file with coordinates for d6eokb_.
(The format of our PDB-style files is described here.)

Timeline for d6eokb_:

  • d6eokb_ appears in periodic updates to SCOPe 2.07 starting on 2018-11-01